RELA monoclonal antibody (M01A), clone 8G3 View larger

Mouse monoclonal antibody raised against a partial recombinant RELA.

AB-H00005970-M01A

New product

RELA monoclonal antibody (M01A), clone 8G3

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 200 uL
Gene Name RELA
Gene Alias MGC131774|NFKB3|p65
Gene Description v-rel reticuloendotheliosis viral oncogene homolog A (avian)
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq GEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RELA (NP_068810, 432 a.a. ~ 505 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 5970
Clone Number 8G3
Iso type IgG1 Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant RELA.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant RELA.

Mouse monoclonal antibody raised against a partial recombinant RELA.