RELA monoclonal antibody (M01), clone 8G3
  • RELA monoclonal antibody (M01), clone 8G3

RELA monoclonal antibody (M01), clone 8G3

Ref: AB-H00005970-M01
RELA monoclonal antibody (M01), clone 8G3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RELA.
Información adicional
Size 100 ug
Gene Name RELA
Gene Alias MGC131774|NFKB3|p65
Gene Description v-rel reticuloendotheliosis viral oncogene homolog A (avian)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,PLA-Ce,IF
Immunogen Prot. Seq GEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RELA (NP_068810, 432 a.a. ~ 505 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5970
Clone Number 8G3
Iso type IgG1 Lambda

Enviar uma mensagem


RELA monoclonal antibody (M01), clone 8G3

RELA monoclonal antibody (M01), clone 8G3