RDH5 polyclonal antibody (A01)
  • RDH5 polyclonal antibody (A01)

RDH5 polyclonal antibody (A01)

Ref: AB-H00005959-A01
RDH5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RDH5.
Información adicional
Size 50 uL
Gene Name RDH5
Gene Alias FLJ39337|FLJ97089|HSD17B9|RDH1|SDR9C5
Gene Description retinol dehydrogenase 5 (11-cis/9-cis)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GLEAFSDSLRRDVAHFGIRVSIVEPGFFRTPVTNLESLEKTLQACWARLPPATQAHYGGAFLTKYLKMQQRIMNLICDPDLTKVSRCLEHALTARHPRTR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RDH5 (AAH28298, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5959

Enviar uma mensagem


RDH5 polyclonal antibody (A01)

RDH5 polyclonal antibody (A01)