RCVRN monoclonal antibody (M18C), clone 3D1
  • RCVRN monoclonal antibody (M18C), clone 3D1

RCVRN monoclonal antibody (M18C), clone 3D1

Ref: AB-H00005957-M18C
RCVRN monoclonal antibody (M18C), clone 3D1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RCVRN.
This product is belong to Cell Culture Grade Antibody (CX Grade).
Información adicional
Size 200 uL
Gene Name RCVRN
Gene Alias RCV1
Gene Description recoverin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq NSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RCVRN (NP_002894.1, 3 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In condensed culture supernatant
Gene ID 5957
Clone Number 3D1
Iso type IgG2a Kappa

Enviar uma mensagem


RCVRN monoclonal antibody (M18C), clone 3D1

RCVRN monoclonal antibody (M18C), clone 3D1