RCV1 monoclonal antibody (M03), clone 1D3
  • RCV1 monoclonal antibody (M03), clone 1D3

RCV1 monoclonal antibody (M03), clone 1D3

Ref: AB-H00005957-M03
RCV1 monoclonal antibody (M03), clone 1D3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RCV1.
Información adicional
Size 100 ug
Gene Name RCVRN
Gene Alias RCV1
Gene Description recoverin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq KLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RCV1 (NP_002894.1, 101 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5957
Clone Number 1D3
Iso type IgG1 Kappa

Enviar uma mensagem


RCV1 monoclonal antibody (M03), clone 1D3

RCV1 monoclonal antibody (M03), clone 1D3