RCV1 monoclonal antibody (M02A), clone 3G10
  • RCV1 monoclonal antibody (M02A), clone 3G10

RCV1 monoclonal antibody (M02A), clone 3G10

Ref: AB-H00005957-M02A
RCV1 monoclonal antibody (M02A), clone 3G10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RCV1.
Información adicional
Size 200 uL
Gene Name RCVRN
Gene Alias RCV1
Gene Description recoverin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,ELISA
Immunogen Prot. Seq KLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RCV1 (NP_002894.1, 101 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 5957
Clone Number 3G10
Iso type IgG1 Kappa

Enviar uma mensagem


RCV1 monoclonal antibody (M02A), clone 3G10

RCV1 monoclonal antibody (M02A), clone 3G10