RCN1 polyclonal antibody (A01)
  • RCN1 polyclonal antibody (A01)

RCN1 polyclonal antibody (A01)

Ref: AB-H00005954-A01
RCN1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant RCN1.
Información adicional
Size 50 uL
Gene Name RCN1
Gene Alias FLJ37041|PIG20|RCAL|RCN
Gene Description reticulocalbin 1, EF-hand calcium binding domain
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RCN1 (AAH10120, 31 a.a. ~ 331 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5954

Enviar uma mensagem


RCN1 polyclonal antibody (A01)

RCN1 polyclonal antibody (A01)