RBP4 monoclonal antibody (M09), clone 4B10
  • RBP4 monoclonal antibody (M09), clone 4B10

RBP4 monoclonal antibody (M09), clone 4B10

Ref: AB-H00005950-M09
RBP4 monoclonal antibody (M09), clone 4B10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RBP4.
Información adicional
Size 100 ug
Gene Name RBP4
Gene Alias -
Gene Description retinol binding protein 4, plasma
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq KFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RBP4 (NP_006735.2, 103 a.a. ~ 201 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5950
Clone Number 4B10
Iso type IgG2a Kappa

Enviar uma mensagem


RBP4 monoclonal antibody (M09), clone 4B10

RBP4 monoclonal antibody (M09), clone 4B10