RBP3 monoclonal antibody (M01), clone 4F3
  • RBP3 monoclonal antibody (M01), clone 4F3

RBP3 monoclonal antibody (M01), clone 4F3

Ref: AB-H00005949-M01
RBP3 monoclonal antibody (M01), clone 4F3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RBP3.
Información adicional
Size 100 ug
Gene Name RBP3
Gene Alias D10S64|D10S65|D10S66|IRBP|RBPI
Gene Description retinol binding protein 3, interstitial
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq GTAEEFTYIMKRLGRALVIGEVTSGGCQPPQTYHVDDTNLYLTIPTARSVGASDGSSWEGVGVTPHVVVPAEEALARAKEMLQHNQLRVKRSPGLQDH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RBP3 (NP_002891, 1149 a.a. ~ 1246 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5949
Clone Number 4F3
Iso type IgG2a Kappa

Enviar uma mensagem


RBP3 monoclonal antibody (M01), clone 4F3

RBP3 monoclonal antibody (M01), clone 4F3