RBP3 polyclonal antibody (A01)
  • RBP3 polyclonal antibody (A01)

RBP3 polyclonal antibody (A01)

Ref: AB-H00005949-A01
RBP3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RBP3.
Información adicional
Size 50 uL
Gene Name RBP3
Gene Alias D10S64|D10S65|D10S66|IRBP|RBPI
Gene Description retinol binding protein 3, interstitial
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq GTAEEFTYIMKRLGRALVIGEVTSGGCQPPQTYHVDDTNLYLTIPTARSVGASDGSSWEGVGVTPHVVVPAEEALARAKEMLQHNQLRVKRSPGLQDH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RBP3 (NP_002891, 1149 a.a. ~ 1246 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5949

Enviar uma mensagem


RBP3 polyclonal antibody (A01)

RBP3 polyclonal antibody (A01)