RBL2 polyclonal antibody (A01)
  • RBL2 polyclonal antibody (A01)

RBL2 polyclonal antibody (A01)

Ref: AB-H00005934-A01
RBL2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RBL2.
Información adicional
Size 50 uL
Gene Name RBL2
Gene Alias FLJ26459|P130|Rb2
Gene Description retinoblastoma-like 2 (p130)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VTPVSTATHSLSRLHTMLTGLRNAPSEKLEQILRTCSRDPTQAIANRLKEMFEIYSQHFQPDEDFSNCAKEIASKHFRFAEMLYYKVLESVIEQEQKRLG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RBL2 (NP_005602, 416 a.a. ~ 515 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5934

Enviar uma mensagem


RBL2 polyclonal antibody (A01)

RBL2 polyclonal antibody (A01)