RBBP4 purified MaxPab rabbit polyclonal antibody (D01P)
  • RBBP4 purified MaxPab rabbit polyclonal antibody (D01P)

RBBP4 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005928-D01P
RBBP4 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RBBP4 protein.
Información adicional
Size 100 ug
Gene Name RBBP4
Gene Alias NURF55|RBAP48
Gene Description retinoblastoma binding protein 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce
Immunogen Prot. Seq MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIW
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RBBP4 (NP_005601.1, 1 a.a. ~ 425 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5928

Enviar uma mensagem


RBBP4 purified MaxPab rabbit polyclonal antibody (D01P)

RBBP4 purified MaxPab rabbit polyclonal antibody (D01P)