JARID1A monoclonal antibody (M03), clone 1H2
  • JARID1A monoclonal antibody (M03), clone 1H2

JARID1A monoclonal antibody (M03), clone 1H2

Ref: AB-H00005927-M03
JARID1A monoclonal antibody (M03), clone 1H2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant JARID1A.
Información adicional
Size 100 ug
Gene Name JARID1A
Gene Alias KDM5A|RBBP2|RBP2
Gene Description jumonji, AT rich interactive domain 1A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq KVEPEVLSTDTQTSPEPGTRMNILPKRTRRVKTQSESGDVSRNTELKKLQIFGAGPKVVGLAMGTKDKEDEVTRRRKVTNRSDAFNMQMRQRKGTLSVNF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen JARID1A (NP_005047, 191 a.a. ~ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5927
Clone Number 1H2
Iso type IgG2a Kappa

Enviar uma mensagem


JARID1A monoclonal antibody (M03), clone 1H2

JARID1A monoclonal antibody (M03), clone 1H2