ARID4A monoclonal antibody (M01), clone 2G8
  • ARID4A monoclonal antibody (M01), clone 2G8

ARID4A monoclonal antibody (M01), clone 2G8

Ref: AB-H00005926-M01
ARID4A monoclonal antibody (M01), clone 2G8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ARID4A.
Información adicional
Size 100 ug
Gene Name ARID4A
Gene Alias RBBP1|RBP-1|RBP1
Gene Description AT rich interactive domain 4A (RBP1-like)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,IF
Immunogen Prot. Seq AEESQEGLCERESANGFETNVASGTCSIIVQERESREKGQKRPSDGNSGLMAKKQKRTPKRTSAAAKNEKNGTGQSSDSEDLPVLDNSSKCTPVKHLNVSKPQKLAR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ARID4A (NP_002883, 1033 a.a. ~ 1139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5926
Clone Number 2G8
Iso type IgG1 Kappa

Enviar uma mensagem


ARID4A monoclonal antibody (M01), clone 2G8

ARID4A monoclonal antibody (M01), clone 2G8