ARID4A polyclonal antibody (A01)
  • ARID4A polyclonal antibody (A01)

ARID4A polyclonal antibody (A01)

Ref: AB-H00005926-A01
ARID4A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ARID4A.
Información adicional
Size 50 uL
Gene Name ARID4A
Gene Alias RBBP1|RBP-1|RBP1
Gene Description AT rich interactive domain 4A (RBP1-like)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq AEESQEGLCERESANGFETNVASGTCSIIVQERESREKGQKRPSDGNSGLMAKKQKRTPKRTSAAAKNEKNGTGQSSDSEDLPVLDNSSKCTPVKHLNVSKPQKLAR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ARID4A (NP_002883, 1033 a.a. ~ 1139 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5926

Enviar uma mensagem


ARID4A polyclonal antibody (A01)

ARID4A polyclonal antibody (A01)