RARRES3 monoclonal antibody (M10), clone 1H5
  • RARRES3 monoclonal antibody (M10), clone 1H5

RARRES3 monoclonal antibody (M10), clone 1H5

Ref: AB-H00005920-M10
RARRES3 monoclonal antibody (M10), clone 1H5

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant RARRES3.
Información adicional
Size 100 ug
Gene Name RARRES3
Gene Alias HRASLS4|MGC8906|RIG1|TIG3
Gene Description retinoic acid receptor responder (tazarotene induced) 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,ELISA
Immunogen Prot. Seq MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQLRYGKSRCKQVEKAKVEVGVATALGILVVAGCSFAIRRYQKKATA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RARRES3 (AAH09678, 1 a.a. ~ 164 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5920
Clone Number 1H5
Iso type IgG2a Kappa

Enviar uma mensagem


RARRES3 monoclonal antibody (M10), clone 1H5

RARRES3 monoclonal antibody (M10), clone 1H5