RARRES1 monoclonal antibody (M06), clone 2E2
  • RARRES1 monoclonal antibody (M06), clone 2E2

RARRES1 monoclonal antibody (M06), clone 2E2

Ref: AB-H00005918-M06
RARRES1 monoclonal antibody (M06), clone 2E2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RARRES1.
Información adicional
Size 100 ug
Gene Name RARRES1
Gene Alias TIG1
Gene Description retinoic acid receptor responder (tazarotene induced) 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq EMTTQVSHYYLAQLTSVRQWKTNDDTIDFDYTVLLHELSTQEIIPCRIHLVWYPGKPLKVKYHCQELQTPEEASGTEEGSAVVPTELSNF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RARRES1 (NP_996846, 205 a.a. ~ 294 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5918
Clone Number 2E2
Iso type IgG2a Kappa

Enviar uma mensagem


RARRES1 monoclonal antibody (M06), clone 2E2

RARRES1 monoclonal antibody (M06), clone 2E2