RARRES1 polyclonal antibody (A01)
  • RARRES1 polyclonal antibody (A01)

RARRES1 polyclonal antibody (A01)

Ref: AB-H00005918-A01
RARRES1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RARRES1.
Información adicional
Size 50 uL
Gene Name RARRES1
Gene Alias TIG1
Gene Description retinoic acid receptor responder (tazarotene induced) 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EMTTQVSHYYLAQLTSVRQWKTNDDTIDFDYTVLLHELSTQEIIPCRIHLVWYPGKPLKVKYHCQELQTPEEASGTEEGSAVVPTELSNF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RARRES1 (NP_996846, 205 a.a. ~ 294 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5918

Enviar uma mensagem


RARRES1 polyclonal antibody (A01)

RARRES1 polyclonal antibody (A01)