RARS monoclonal antibody (M02), clone 1A2
  • RARS monoclonal antibody (M02), clone 1A2

RARS monoclonal antibody (M02), clone 1A2

Ref: AB-H00005917-M02
RARS monoclonal antibody (M02), clone 1A2

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant RARS.
Información adicional
Size 100 ug
Gene Name RARS
Gene Alias ArgRS|DALRD1|MGC8641
Gene Description arginyl-tRNA synthetase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,ELISA
Immunogen Prot. Seq MDVLVSECSARLLQQEEEIKSLTAEIDRLKNCGCLGASPNLEQLQEENLKLKYRLNILRKSLQAERNKPTKNMINIISRLQEVFGHAIKAAYPDLENPPLLVTPSQQAKFGDYQCNSAMGISQMLKTKEQKVNPREIAENITKHLPDNECIEKVEIAGPGFINVHLRKDFVSEQLTSLLVNGVQLPALGENKKVIVDFSSPNIAKEMHVGHLRSTIIGESISRLFEFAGYDVLRLNHVGDWGTQFGMLIAHLQDK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RARS (AAH00528, 1 a.a. ~ 660 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5917
Clone Number 1A2
Iso type IgG2b Kappa

Enviar uma mensagem


RARS monoclonal antibody (M02), clone 1A2

RARS monoclonal antibody (M02), clone 1A2