RARG purified MaxPab mouse polyclonal antibody (B02P)
  • RARG purified MaxPab mouse polyclonal antibody (B02P)

RARG purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00005916-B02P
RARG purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RARG protein.
Información adicional
Size 50 ug
Gene Name RARG
Gene Alias NR1B3|RARC
Gene Description retinoic acid receptor, gamma
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RARG (NP_000957.1, 1 a.a. ~ 454 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5916

Enviar uma mensagem


RARG purified MaxPab mouse polyclonal antibody (B02P)

RARG purified MaxPab mouse polyclonal antibody (B02P)