RARB purified MaxPab mouse polyclonal antibody (B01P)
  • RARB purified MaxPab mouse polyclonal antibody (B01P)

RARB purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005915-B01P
RARB purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RARB protein.
Información adicional
Size 50 ug
Gene Name RARB
Gene Alias HAP|NR1B2|RRB2
Gene Description retinoic acid receptor, beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MFDCMDVLSVSPGQILDFYTASPSSCMLQEKALKACFSGLTQTEWQHRHTAQSIETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RARB (NP_000956.2, 1 a.a. ~ 448 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5915

Enviar uma mensagem


RARB purified MaxPab mouse polyclonal antibody (B01P)

RARB purified MaxPab mouse polyclonal antibody (B01P)