RARB polyclonal antibody (A01)
  • RARB polyclonal antibody (A01)

RARB polyclonal antibody (A01)

Ref: AB-H00005915-A01
RARB polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RARB.
Información adicional
Size 50 uL
Gene Name RARB
Gene Alias HAP|NR1B2|RRB2
Gene Description retinoic acid receptor, beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MFDCMDVLSVSPGQILDFYTASPSSCMLQEKALKACFSGLTQTEWQHRHTAQSIETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RARB (AAH60794, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5915

Enviar uma mensagem


RARB polyclonal antibody (A01)

RARB polyclonal antibody (A01)