RARA monoclonal antibody (M09A), clone 2C3
  • RARA monoclonal antibody (M09A), clone 2C3

RARA monoclonal antibody (M09A), clone 2C3

Ref: AB-H00005914-M09A
RARA monoclonal antibody (M09A), clone 2C3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RARA.
Información adicional
Size 200 uL
Gene Name RARA
Gene Alias NR1B1|RAR
Gene Description retinoic acid receptor, alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq QLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RARA (NP_000955, 315 a.a. ~ 424 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 5914
Clone Number 2C3
Iso type IgG1 Kappa

Enviar uma mensagem


RARA monoclonal antibody (M09A), clone 2C3

RARA monoclonal antibody (M09A), clone 2C3