RARA polyclonal antibody (A01)
  • RARA polyclonal antibody (A01)

RARA polyclonal antibody (A01)

Ref: AB-H00005914-A01
RARA polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RARA.
Información adicional
Size 50 uL
Gene Name RARA
Gene Alias NR1B1|RAR
Gene Description retinoic acid receptor, alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RARA (NP_000955, 315 a.a. ~ 424 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5914

Enviar uma mensagem


RARA polyclonal antibody (A01)

RARA polyclonal antibody (A01)