RAP2B polyclonal antibody (A01)
  • RAP2B polyclonal antibody (A01)

RAP2B polyclonal antibody (A01)

Ref: AB-H00005912-A01
RAP2B polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant RAP2B.
Información adicional
Size 50 uL
Gene Name RAP2B
Gene Alias MGC20484
Gene Description RAP2B, member of RAS oncogene family
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDLEGEREVSYGEGKALAEEWSCPFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCCSACVIL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAP2B (AAH12362, 1 a.a. ~ 183 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5912

Enviar uma mensagem


RAP2B polyclonal antibody (A01)

RAP2B polyclonal antibody (A01)