RALGDS purified MaxPab rabbit polyclonal antibody (D01P)
  • RALGDS purified MaxPab rabbit polyclonal antibody (D01P)

RALGDS purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005900-D01P
RALGDS purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RALGDS protein.
Información adicional
Size 100 ug
Gene Name RALGDS
Gene Alias FLJ20922|RGF|RalGEF
Gene Description ral guanine nucleotide dissociation stimulator
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,PLA-Ce
Immunogen Prot. Seq MVQRMWAEAAGPAGGAEPLFPGSRRSRSVWDAVRLEVGVPDSCPVVLHSFTQLDPDLPRPESSTQEIGEELINGVIYSISLRKVQLHHGGNKGQRWLGYENESALNLYETCKVRTVKAGTLEKLVEHLVPAFQGSDLSYVTIFLCTYRAFTTTQQVLDLLFKRYGCILPYSDEDGGPQDQLKNAISSILGTWLDQYSEDFCQPPDFPCLKQLVAYVQLNMPGSDLERRAHLLLAQLEHSEPIEAEPEALSPVPAL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RALGDS (AAH59362.1, 1 a.a. ~ 902 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5900

Enviar uma mensagem


RALGDS purified MaxPab rabbit polyclonal antibody (D01P)

RALGDS purified MaxPab rabbit polyclonal antibody (D01P)