RALGDS MaxPab rabbit polyclonal antibody (D01)
  • RALGDS MaxPab rabbit polyclonal antibody (D01)

RALGDS MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00005900-D01
RALGDS MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RALGDS protein.
Información adicional
Size 100 uL
Gene Name RALGDS
Gene Alias FLJ20922|RGF|RalGEF
Gene Description ral guanine nucleotide dissociation stimulator
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MVQRMWAEAAGPAGGAEPLFPGSRRSRSVWDAVRLEVGVPDSCPVVLHSFTQLDPDLPRPESSTQEIGEELINGVIYSISLRKVQLHHGGNKGQRWLGYENESALNLYETCKVRTVKAGTLEKLVEHLVPAFQGSDLSYVTIFLCTYRAFTTTQQVLDLLFKRYGCILPYSDEDGGPQDQLKNAISSILGTWLDQYSEDFCQPPDFPCLKQLVAYVQLNMPGSDLERRAHLLLAQLEHSEPIEAEPEALSPVPAL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RALGDS (AAH59362.1, 1 a.a. ~ 902 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 5900

Enviar uma mensagem


RALGDS MaxPab rabbit polyclonal antibody (D01)

RALGDS MaxPab rabbit polyclonal antibody (D01)