RALB purified MaxPab rabbit polyclonal antibody (D01P)
  • RALB purified MaxPab rabbit polyclonal antibody (D01P)

RALB purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005899-D01P
RALB purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RALB protein.
Información adicional
Size 100 ug
Gene Name RALB
Gene Alias -
Gene Description v-ral simian leukemia viral oncogene homolog B (ras related
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERCCLL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RALB (NP_002872.1, 1 a.a. ~ 206 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5899

Enviar uma mensagem


RALB purified MaxPab rabbit polyclonal antibody (D01P)

RALB purified MaxPab rabbit polyclonal antibody (D01P)