RAG2 purified MaxPab mouse polyclonal antibody (B01P)
  • RAG2 purified MaxPab mouse polyclonal antibody (B01P)

RAG2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005897-B01P
RAG2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RAG2 protein.
Información adicional
Size 50 ug
Gene Name RAG2
Gene Alias RAG-2
Gene Description recombination activating gene 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MSLQMVTVSNNIALIQPGFSLMNFDGQVFFFGQKGWPKRSCPTGVFHLDVKHNHVKLKPTIFSKDSCYLPPLRYPATCTFKGSLESEKHQYIIHGGKTPNNEVSDKIYVMSIVCKNNKKVTFRCTEKDLVGDVPEARYGHSINVVYSRGKSMGALFGGRSYMPSTHRTTEKWNSVADCLPCVFLVDFEFGCATSYILPELQDGLSFHVSIAKNDTIYILGGHSLANNIRPANLYRIRVDLPLGSPAVNCTVLPGG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RAG2 (NP_000527.1, 1 a.a. ~ 527 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5897

Enviar uma mensagem


RAG2 purified MaxPab mouse polyclonal antibody (B01P)

RAG2 purified MaxPab mouse polyclonal antibody (B01P)