RAF1 monoclonal antibody (M03), clone 1H4
  • RAF1 monoclonal antibody (M03), clone 1H4

RAF1 monoclonal antibody (M03), clone 1H4

Ref: AB-H00005894-M03
RAF1 monoclonal antibody (M03), clone 1H4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RAF1.
Información adicional
Size 100 ug
Gene Name RAF1
Gene Alias CRAF|NS5|Raf-1|c-Raf
Gene Description v-raf-1 murine leukemia viral oncogene homolog 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,WB-Re,ELISA,RNAi-Ab,PLA-Ce
Immunogen Prot. Seq MEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDPSKTSNTIRVFLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAASLIGEELQVDF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAF1 (AAH18119, 1 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5894
Clone Number 1H4
Iso type IgG2b Kappa

Enviar uma mensagem


RAF1 monoclonal antibody (M03), clone 1H4

RAF1 monoclonal antibody (M03), clone 1H4