RAF1 purified MaxPab mouse polyclonal antibody (B01P)
  • RAF1 purified MaxPab mouse polyclonal antibody (B01P)

RAF1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005894-B01P
RAF1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RAF1 protein.
Información adicional
Size 50 ug
Gene Name RAF1
Gene Alias CRAF|NS5|Raf-1|c-Raf
Gene Description v-raf-1 murine leukemia viral oncogene homolog 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDPSKTSNTIRVFLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAASLIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKVPTMCVDWSNIRQLLLFPNSTIGDSGVPALPSLTMRRMRESVSRMPVSSQHRYSTPHAFTFNTSSPSSEGSLSQRQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RAF1 (NP_002871.1, 1 a.a. ~ 648 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5894

Enviar uma mensagem


RAF1 purified MaxPab mouse polyclonal antibody (B01P)

RAF1 purified MaxPab mouse polyclonal antibody (B01P)