RAGE purified MaxPab rabbit polyclonal antibody (D01P)
  • RAGE purified MaxPab rabbit polyclonal antibody (D01P)

RAGE purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005891-D01P
RAGE purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RAGE protein.
Información adicional
Size 100 ug
Gene Name RAGE
Gene Alias MOK|RAGE1
Gene Description renal tumor antigen
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDLWSAGCVFYEIASLQPLFPGVNELDQISKIHDVIGTPAQKILTKFKQSRAMNFDFPFKKGSGIPLLTTNLSPQCLSLLHAMVAYDPDERIAAHQALQHPYFQEQRKTEKRALGSHRKAGFPEHPVAPEPLSNSCQISKEGRKQKQSLKQEEDRPKRRGPAYVMELPKLKLSGVVRLSSYSSPTLQSVLGSGTNGRVPVLRPLKCIPASKKTDPQKDLKPAPQQCRLPTIVRKGGR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RAGE (AAH26069.1, 1 a.a. ~ 237 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5891

Enviar uma mensagem


RAGE purified MaxPab rabbit polyclonal antibody (D01P)

RAGE purified MaxPab rabbit polyclonal antibody (D01P)