RAD51L1 purified MaxPab rabbit polyclonal antibody (D01P)
  • RAD51L1 purified MaxPab rabbit polyclonal antibody (D01P)

RAD51L1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005890-D01P
RAD51L1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RAD51L1 protein.
Información adicional
Size 100 ug
Gene Name RAD51L1
Gene Alias MGC34245|R51H2|RAD51B|REC2|hREC2
Gene Description RAD51-like 1 (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGSKKLKRVGLSQELCDRLSRHQILTCQDFLCLSPLELMKVTGLSYRGVHELLCMVSRACAPKMQTAYGIKAQRSADFSPAFLSTTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIMMSILATLPTNMGGLEGAVVYIDTESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEEEIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVIL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RAD51L1 (NP_598193.2, 1 a.a. ~ 384 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5890

Enviar uma mensagem


RAD51L1 purified MaxPab rabbit polyclonal antibody (D01P)

RAD51L1 purified MaxPab rabbit polyclonal antibody (D01P)