RAD51C purified MaxPab rabbit polyclonal antibody (D01P)
  • RAD51C purified MaxPab rabbit polyclonal antibody (D01P)

RAD51C purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005889-D01P
RAD51C purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RAD51C protein.
Información adicional
Size 100 ug
Gene Name RAD51C
Gene Alias MGC104277|RAD51L2
Gene Description RAD51 homolog C (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEALETLQIIRRECLTNKPRYAGTSESHKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKTTEICGAPGVGKTQLCMQLAVDVQIPECFGGVAGEAVFIDTEGSFMVDRVVDLATACIQHLQLIAEKHKGEEHRKALEDFTLDNILSHIYYFRCRDYTELLAQVYLLPDFLSEHSKVRLVIVDGIAFPFRHDLDDL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RAD51C (NP_478123.1, 1 a.a. ~ 376 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5889

Enviar uma mensagem


RAD51C purified MaxPab rabbit polyclonal antibody (D01P)

RAD51C purified MaxPab rabbit polyclonal antibody (D01P)