RAD23B purified MaxPab rabbit polyclonal antibody (D01P)
  • RAD23B purified MaxPab rabbit polyclonal antibody (D01P)

RAD23B purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005887-D01P
RAD23B purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RAD23B protein.
Información adicional
Size 100 ug
Gene Name RAD23B
Gene Alias HHR23B|HR23B|P58
Gene Description RAD23 homolog B (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALKEYKIDEKNFVVVMVTKPKAVSTPAPATTQQSAPASTTAVTSSTTTTVAQAPTPVPALAPTSTPASITPASATASSEPAPASAAKQEKPAEKPAETPVATSPTATDSTSGDSSRSNLFEDATSALVTGQSYENMVTEIMSMGYEREQVIAALRASFNNPDRAVEYLLMGIPGDRESQAVVDPPQAASTGVPQSSAV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RAD23B (AAH20973.1, 1 a.a. ~ 409 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5887

Enviar uma mensagem


RAD23B purified MaxPab rabbit polyclonal antibody (D01P)

RAD23B purified MaxPab rabbit polyclonal antibody (D01P)