RAC2 polyclonal antibody (A01)
  • RAC2 polyclonal antibody (A01)

RAC2 polyclonal antibody (A01)

Ref: AB-H00005880-A01
RAC2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant RAC2.
Información adicional
Size 50 uL
Gene Name RAC2
Gene Alias EN-7|Gx|HSPC022
Gene Description ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRACSLL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAC2 (AAH01485.1, 1 a.a. ~ 192 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5880

Enviar uma mensagem


RAC2 polyclonal antibody (A01)

RAC2 polyclonal antibody (A01)