RAB27B purified MaxPab mouse polyclonal antibody (B02P)
  • RAB27B purified MaxPab mouse polyclonal antibody (B02P)

RAB27B purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00005874-B02P
RAB27B purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RAB27B protein.
Información adicional
Size 50 ug
Gene Name RAB27B
Gene Alias -
Gene Description RAB27B, member RAS oncogene family
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RAB27B (ABW03319.1, 1 a.a. ~ 218 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5874

Enviar uma mensagem


RAB27B purified MaxPab mouse polyclonal antibody (B02P)

RAB27B purified MaxPab mouse polyclonal antibody (B02P)