RAB4A monoclonal antibody (M02), clone 1E1
  • RAB4A monoclonal antibody (M02), clone 1E1

RAB4A monoclonal antibody (M02), clone 1E1

Ref: AB-H00005867-M02
RAB4A monoclonal antibody (M02), clone 1E1

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant RAB4A.
Información adicional
Size 100 ug
Gene Name RAB4A
Gene Alias HRES-1/RAB4|RAB4
Gene Description RAB4A, member RAS oncogene family
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MSQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECGC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAB4A (AAH04309, 1 a.a. ~ 218 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5867
Clone Number 1E1
Iso type IgG1 Kappa

Enviar uma mensagem


RAB4A monoclonal antibody (M02), clone 1E1

RAB4A monoclonal antibody (M02), clone 1E1