RAB3A monoclonal antibody (M01), clone 4H7
  • RAB3A monoclonal antibody (M01), clone 4H7

RAB3A monoclonal antibody (M01), clone 4H7

Ref: AB-H00005864-M01
RAB3A monoclonal antibody (M01), clone 4H7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RAB3A.
Información adicional
Size 100 ug
Gene Name RAB3A
Gene Alias -
Gene Description RAB3A, member RAS oncogene family
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq TYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCAC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAB3A (NP_002857, 122 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5864
Clone Number 4H7
Iso type IgG1 Kappa

Enviar uma mensagem


RAB3A monoclonal antibody (M01), clone 4H7

RAB3A monoclonal antibody (M01), clone 4H7