QDPR polyclonal antibody (A01)
  • QDPR polyclonal antibody (A01)

QDPR polyclonal antibody (A01)

Ref: AB-H00005860-A01
QDPR polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant QDPR.
Información adicional
Size 50 uL
Gene Name QDPR
Gene Alias DHPR|FLJ42391|PKU2|SDR33C1
Gene Description quinoid dihydropteridine reductase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAAAAAAGEARRVLVYGGRGALGSRCVQAFRARNWWVASVDVVENEEASASIIVKMTDSFTEQADQVTAEVGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGKNRPSSGSLIQVVTTEGRTELTPAYF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen QDPR (AAH00576, 1 a.a. ~ 244 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5860

Enviar uma mensagem


QDPR polyclonal antibody (A01)

QDPR polyclonal antibody (A01)