PYGL MaxPab rabbit polyclonal antibody (D01)
  • PYGL MaxPab rabbit polyclonal antibody (D01)

PYGL MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00005836-D01
PYGL MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PYGL protein.
Información adicional
Size 100 uL
Gene Name PYGL
Gene Alias GSD6
Gene Description phosphorylase, glycogen, liver
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MAKPLTDQEKRRQISIRGIVGVENVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDIEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTKWIDTQVVLALPYDTPVPGYMNNTVNTMRLWSARAPNDFNL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PYGL (NP_002854.3, 1 a.a. ~ 847 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 5836

Enviar uma mensagem


PYGL MaxPab rabbit polyclonal antibody (D01)

PYGL MaxPab rabbit polyclonal antibody (D01)