PCYT2 purified MaxPab rabbit polyclonal antibody (D01P)
  • PCYT2 purified MaxPab rabbit polyclonal antibody (D01P)

PCYT2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005833-D01P
PCYT2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PCYT2 protein.
Información adicional
Size 100 ug
Gene Name PCYT2
Gene Alias ET
Gene Description phosphate cytidylyltransferase 2, ethanolamine
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MIRNGRGAAGGAEQPGPGGRRAVRVWCDGCYDMVHYGHSNQLRQARAMGDYLIVGVHTDEEIAKHKGPPVFTQEERYKMVQAIKWVDEVVPAAPYVTTLETLDKYNCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLVTKAHHSSQEMSSEYREYADSFGKCPGGRNPWTGVSQFLQTSQKIIQFASGKEPQPGETVIYVAGAFDLFHIGHVDFLEKVHRLAERPYIIAGLHFDQEV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PCYT2 (NP_002852.1, 1 a.a. ~ 389 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5833

Enviar uma mensagem


PCYT2 purified MaxPab rabbit polyclonal antibody (D01P)

PCYT2 purified MaxPab rabbit polyclonal antibody (D01P)