PCYT2 polyclonal antibody (A01)
  • PCYT2 polyclonal antibody (A01)

PCYT2 polyclonal antibody (A01)

Ref: AB-H00005833-A01
PCYT2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PCYT2.
Información adicional
Size 50 uL
Gene Name PCYT2
Gene Alias ET
Gene Description phosphate cytidylyltransferase 2, ethanolamine
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq VWCDGCYDMVHYGHSNQLRQARAMGDYLIVGVHTDEEIAKHKGPPVFTQEERYKMVQAIKWVDEVVPAAPYVTTLETLDKYNCDFCVHGNDITLTVDGR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCYT2 (NP_002852, 25 a.a. ~ 123 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5833

Enviar uma mensagem


PCYT2 polyclonal antibody (A01)

PCYT2 polyclonal antibody (A01)