PVRL2 monoclonal antibody (M01), clone 2A6-2C1
  • PVRL2 monoclonal antibody (M01), clone 2A6-2C1

PVRL2 monoclonal antibody (M01), clone 2A6-2C1

Ref: AB-H00005819-M01
PVRL2 monoclonal antibody (M01), clone 2A6-2C1

Información del producto

Mouse monoclonal antibody raised against a full length recombinant PVRL2.
Información adicional
Size 100 ug
Gene Name PVRL2
Gene Alias CD112|HVEB|PRR2|PVRR2
Gene Description poliovirus receptor-related 2 (herpesvirus entry mediator B)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq MARAAALLPSRSPPTPLLWPLLLLLFLETGAQDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PVRL2 (AAH03091, 1 a.a. ~ 479 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5819
Clone Number 2A6-2C1
Iso type IgG2a kappa

Enviar uma mensagem


PVRL2 monoclonal antibody (M01), clone 2A6-2C1

PVRL2 monoclonal antibody (M01), clone 2A6-2C1