PVR purified MaxPab rabbit polyclonal antibody (D01P)
  • PVR purified MaxPab rabbit polyclonal antibody (D01P)

PVR purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005817-D01P
PVR purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PVR protein.
Información adicional
Size 100 ug
Gene Name PVR
Gene Alias CD155|FLJ25946|HVED|NECL5|Necl-5|PVS|TAGE4
Gene Description poliovirus receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MARAMAAAWPLLLVALLVLSWPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNW
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PVR (NP_006496.2, 1 a.a. ~ 417 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5817

Enviar uma mensagem


PVR purified MaxPab rabbit polyclonal antibody (D01P)

PVR purified MaxPab rabbit polyclonal antibody (D01P)