RAD1 monoclonal antibody (M04), clone 1A12
  • RAD1 monoclonal antibody (M04), clone 1A12

RAD1 monoclonal antibody (M04), clone 1A12

Ref: AB-H00005810-M04
RAD1 monoclonal antibody (M04), clone 1A12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RAD1.
Información adicional
Size 100 ug
Gene Name RAD1
Gene Alias HRAD1|REC1
Gene Description RAD1 homolog (S. pombe)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MPLLTQQIQDEDDQYSLVASLDNVRNLSTILKAIHFREHATCFATKNGIKVTVENAKCVQANAFIQAGIFQEFKVQEESVTFRINLTVLL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAD1 (AAH06837, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5810
Clone Number 1A12
Iso type IgG3 Kappa

Enviar uma mensagem


RAD1 monoclonal antibody (M04), clone 1A12

RAD1 monoclonal antibody (M04), clone 1A12