PTS MaxPab rabbit polyclonal antibody (D01)
  • PTS MaxPab rabbit polyclonal antibody (D01)

PTS MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00005805-D01
PTS MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PTS protein.
Información adicional
Size 100 uL
Gene Name PTS
Gene Alias FLJ97081|PTPS
Gene Description 6-pyruvoyltetrahydropterin synthase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MSTEGGGRRCQAQVSRRISFSASHRLYSKFLSDEENLKLFGKCNNPNGHGHNYKVVVTVHGEIDPATGMVMNLADLKKYMEEAIMQPLDHKNLDMDVPYFADVVSTTENVAVYIWDNLQKVLPVGVLYKVKVYETDNNIVVYKGE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PTS (NP_000308.1, 1 a.a. ~ 145 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 5805

Enviar uma mensagem


PTS MaxPab rabbit polyclonal antibody (D01)

PTS MaxPab rabbit polyclonal antibody (D01)