PTS purified MaxPab mouse polyclonal antibody (B01P)
  • PTS purified MaxPab mouse polyclonal antibody (B01P)

PTS purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005805-B01P
PTS purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PTS protein.
Información adicional
Size 50 ug
Gene Name PTS
Gene Alias FLJ97081|PTPS
Gene Description 6-pyruvoyltetrahydropterin synthase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MSTEGGGRRCQAQVSRRISFSASHRLYSKFLSDEENLKLFGKCNNPNGHGHNYKVVVTVHGEIDPATGMVMNLADLKKYMEEAIMQPLDHKNLDMDVPYFADVVSTTENVAVYIWDNLQKVLPVGVLYKVKVYETDNNIVVYKGE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PTS (NP_000308.1, 1 a.a. ~ 145 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5805

Enviar uma mensagem


PTS purified MaxPab mouse polyclonal antibody (B01P)

PTS purified MaxPab mouse polyclonal antibody (B01P)