PTPRR purified MaxPab rabbit polyclonal antibody (D01P)
  • PTPRR purified MaxPab rabbit polyclonal antibody (D01P)

PTPRR purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005801-D01P
PTPRR purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PTPRR protein.
Información adicional
Size 100 ug
Gene Name PTPRR
Gene Alias DKFZp781C1038|EC-PTP|FLJ34328|MGC131968|MGC148170|PCPTP1|PTP-SL|PTPBR7|PTPRQ
Gene Description protein tyrosine phosphatase, receptor type, R
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,PLA-Ce
Immunogen Prot. Seq MRRAVCFPALCLLLNLHAAGCFSGNNDHFLAINQKKSGKPVFIYKHSQDIEKSLDIAPQKIYRHSYHSSSEAQVSKRHQIVNSAFPRPAYDPSLNLLAMDGQDLEVENLPIPAANVIVVTLQMDVNKLNITLLRIFRQGVAAALGLLPQQVHINRLIGKKNSIELFVSPINRKTGISDALPSEEVLRSLNINVLHQSLSQFGITEVSPEKNVLQGQHEADKIWSKEGFYAVVIFLSIFVIIVTCLMILYRLKERF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PTPRR (NP_002840.1, 1 a.a. ~ 657 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5801

Enviar uma mensagem


PTPRR purified MaxPab rabbit polyclonal antibody (D01P)

PTPRR purified MaxPab rabbit polyclonal antibody (D01P)