View larger
Rabbit polyclonal antibody raised against a full-length human PTPRR protein.
AB-H00005801-D01P
New product
PTPRR purified MaxPab rabbit polyclonal antibody (D01P)
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | PTPRR |
| Gene Alias | DKFZp781C1038|EC-PTP|FLJ34328|MGC131968|MGC148170|PCPTP1|PTP-SL|PTPBR7|PTPRQ |
| Gene Description | protein tyrosine phosphatase, receptor type, R |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,PLA-Ce |
| Immunogen Prot. Seq | MRRAVCFPALCLLLNLHAAGCFSGNNDHFLAINQKKSGKPVFIYKHSQDIEKSLDIAPQKIYRHSYHSSSEAQVSKRHQIVNSAFPRPAYDPSLNLLAMDGQDLEVENLPIPAANVIVVTLQMDVNKLNITLLRIFRQGVAAALGLLPQQVHINRLIGKKNSIELFVSPINRKTGISDALPSEEVLRSLNINVLHQSLSQFGITEVSPEKNVLQGQHEADKIWSKEGFYAVVIFLSIFVIIVTCLMILYRLKERF |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | PTPRR (NP_002840.1, 1 a.a. ~ 657 a.a) full-length human protein. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 5801 |
More info
Rabbit polyclonal antibody raised against a full-length human PTPRR protein.