PTPRN monoclonal antibody (M07), clone 8E3
  • PTPRN monoclonal antibody (M07), clone 8E3

PTPRN monoclonal antibody (M07), clone 8E3

Ref: AB-H00005798-M07
PTPRN monoclonal antibody (M07), clone 8E3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PTPRN.
Información adicional
Size 100 ug
Gene Name PTPRN
Gene Alias FLJ16131|IA-2|IA-2/PTP|IA2|ICA512|R-PTP-N
Gene Description protein tyrosine phosphatase, receptor type, N
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LLQPYLFHQFGSRDGSRVSEGSPGMVSVGPLPKAEAPALFSRTASKGIFGDHPGHSYGDLPGPSPAQLFQDSGLLYLAQELPAPSRARVPRLPEQGSSSRAEDSPEG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PTPRN (NP_002837, 205 a.a. ~ 311 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5798
Clone Number 8E3
Iso type IgG2a Kappa

Enviar uma mensagem


PTPRN monoclonal antibody (M07), clone 8E3

PTPRN monoclonal antibody (M07), clone 8E3